TNF Alpha Polyclonal Antibody (AA 202-235)

2-1-1-green-tea-extract-1

TNF Alpha Polyclonal Antibody (AA 202-235)

Cat. No.: SPODRP00758
Size:
Quantity:
Pricey: Inquiry

Product Details

Target: TNF alpha (Tumor necrosis factor alpha (TNF-α))
Binding Specificity: AA 202-235
Reactivity: Mouse
Host: Rabbit
Clonality: Polyclonal
Conjugate: This TNF alpha antibody is un-conjugated
Application: Western blotting (WB)
Purification: Antigen affinity purified
Immunogen: Amino acids 202-235 (FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL) from the mouse protein were used as the immunogen for the TNF alpha antibody.
Isotype: IgG
Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water.
Handling Advice: Avoid repeated freezing and thawing.
Storage: - 20°C
Storage Comment: After reconstitution, the TNF alpha antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at - 20°C.
Alternative Name: TNF alpha
Synonyms: DIF, TNF-alpha, TNFA, TNFSF2, RATTNF, Tnfa, tnf, TNF-a, TNFalpha, Tnfsf1a, TNFa, cTNF, Tnf-alpha, tnfa-like, TNF-ALPHA, dif, tnfa, xtnf, tnfsf2, tnf-alpha, Cachectin, tumor necrosis factor, tumor necrosis factor b (TNF superfamily, member 2), tumor necrosis factor alpha, tumor necrosis factor a (TNF superfamily, member 2), TNF, Tnf, tnf, tnfb, tnf-alpha, LOC103694380, tnfa.
Background: This gene encodes a versatile proinflammatory cytokine belonging to the tumor necrosis factor (TNF) superfamily. Primarily secreted by macrophages, it exerts its effects through receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Involved in regulating diverse biological processes such as cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation, this cytokine is implicated in various diseases including autoimmune diseases, insulin resistance, and cancer.

Get in Touch
Contact Info
Copyright © Alta Stomatology. All Rights Reserved.
Top