Cat. No.: | SPODRP00758 |
Size: | |
Quantity: |
|
Pricey: | Inquiry |
Target: | TNF alpha (Tumor necrosis factor alpha (TNF-α)) |
Binding Specificity: | AA 202-235 |
Reactivity: | Mouse |
Host: | Rabbit |
Clonality: | Polyclonal |
Conjugate: | This TNF alpha antibody is un-conjugated |
Application: | Western blotting (WB) |
Purification: | Antigen affinity purified |
Immunogen: | Amino acids 202-235 (FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL) from the mouse protein were used as the immunogen for the TNF alpha antibody. |
Isotype: | IgG |
Buffer: | 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water. |
Handling Advice: | Avoid repeated freezing and thawing. |
Storage: | - 20°C |
Storage Comment: | After reconstitution, the TNF alpha antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at - 20°C. |
Alternative Name: | TNF alpha |
Synonyms: | DIF, TNF-alpha, TNFA, TNFSF2, RATTNF, Tnfa, tnf, TNF-a, TNFalpha, Tnfsf1a, TNFa, cTNF, Tnf-alpha, tnfa-like, TNF-ALPHA, dif, tnfa, xtnf, tnfsf2, tnf-alpha, Cachectin, tumor necrosis factor, tumor necrosis factor b (TNF superfamily, member 2), tumor necrosis factor alpha, tumor necrosis factor a (TNF superfamily, member 2), TNF, Tnf, tnf, tnfb, tnf-alpha, LOC103694380, tnfa. |
Background: | This gene encodes a versatile proinflammatory cytokine belonging to the tumor necrosis factor (TNF) superfamily. Primarily secreted by macrophages, it exerts its effects through receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Involved in regulating diverse biological processes such as cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation, this cytokine is implicated in various diseases including autoimmune diseases, insulin resistance, and cancer. |