Rabbit Cytokeratin 13 Polyclonal Antibody, FITC

2-1-1-green-tea-extract-1

Rabbit Cytokeratin 13 Polyclonal Antibody, FITC

Cat. No.: SPBOROT0152
Size:
Quantity:
Price: Inquiry

Product Details

Conjugate/Tag: FITC
Clonality: Polyclonal
Specificity: Recognizes cytokeratin 13.
Species Reactivity: Human, mouse, rat
Host: Rabbit
Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Isotype: IgG
Immunogen: C-terminus of KRT13 corresponding to EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP.
Purification: Purified by protein A affinity chromatography.
Storage: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C.

Get in Touch
Contact Info
Copyright © Alta Stomatology. All Rights Reserved.
Top