| Clonality: |
Polyclonal |
| Binding Specificity: |
AA 119-153, N-Term |
| Species Reactivity: |
Human |
| Host: |
Rabbit |
| Format: |
Lyophilized |
| Concentration: |
500 μg/mL |
| Isotype: |
IgG |
| Immunogen: |
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids. |
| Buffer: |
Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg sodium azide. |
| Purification: |
Immunogen affinity purified. |
| Application: |
WB, ELISA, IHC (p). |
| Storage: |
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing. |
