MMP8 Polyclonal Antibody (AA 119-153, N-Term)

2-1-1-green-tea-extract-1

MMP8 Polyclonal Antibody (AA 119-153, N-Term)

Cat. No.: SPBOROT1415
Size:
Quantity:
Price: Inquiry

Product Details

Clonality: Polyclonal
Binding Specificity: AA 119-153, N-Term
Species Reactivity: Human
Host: Rabbit
Format: Lyophilized
Concentration: 500 μg/mL
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids.
Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg sodium azide.
Purification: Immunogen affinity purified.
Application: WB, ELISA, IHC (p).
Storage: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Get in Touch
Contact Info
Copyright © Alta Stomatology. All Rights Reserved.
Top