Cat. No.: | SPBOROT1415 |
Size: | |
Quantity: |
|
Price: | Inquiry |
Clonality: | Polyclonal |
Binding Specificity: | AA 119-153, N-Term |
Species Reactivity: | Human |
Host: | Rabbit |
Format: | Lyophilized |
Concentration: | 500 μg/mL |
Isotype: | IgG |
Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids. |
Buffer: | Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg sodium azide. |
Purification: | Immunogen affinity purified. |
Application: | WB, ELISA, IHC (p). |
Storage: | At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing. |